Recombinant Human RGS13 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RGS13 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-159 of Human RGS13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF

Protein/Peptide Type
Recombinant Protein
Gene
RGS13

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RGS13 Protein

  • MGC17173
  • regulator of G-protein signaling 13
  • regulator of G-protein signalling 13

Background

The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-20148
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
AF470
Species: Mu
Applications: WB, IHC, Neut
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for RGS13 Recombinant Protein (H00006003-P02) (0)

There are no publications for RGS13 Recombinant Protein (H00006003-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS13 Recombinant Protein (H00006003-P02) (0)

There are no reviews for RGS13 Recombinant Protein (H00006003-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS13 Recombinant Protein (H00006003-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS13 Products

Bioinformatics Tool for RGS13 Recombinant Protein (H00006003-P02)

Discover related pathways, diseases and genes to RGS13 Recombinant Protein (H00006003-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS13 Recombinant Protein (H00006003-P02)

Discover more about diseases related to RGS13 Recombinant Protein (H00006003-P02).
 

Pathways for RGS13 Recombinant Protein (H00006003-P02)

View related products by pathway.

PTMs for RGS13 Recombinant Protein (H00006003-P02)

Learn more about PTMs related to RGS13 Recombinant Protein (H00006003-P02).
 

Research Areas for RGS13 Recombinant Protein (H00006003-P02)

Find related products by research area.

Blogs on RGS13

There are no specific blogs for RGS13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RGS13 Antibody
NBP1-31769

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RGS13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS13