RGS13 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related RGS13 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-92328PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RGS13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RGS13.

Source: E. coli

Amino Acid Sequence: RNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RGS13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92328.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RGS13 Recombinant Protein Antigen

  • MGC17173
  • regulator of G-protein signaling 13
  • regulator of G-protein signalling 13

Background

RGS13 is encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1029
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-01584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00005997-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, KD, WB
350-NS
Species: Fe, Hu, RM
Applications: BA, BA
NBP2-24516
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-38632
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NLS418
Species: Hu
Applications: IHC,  IHC-P
NBP1-86020
Species: Hu
Applications: IHC,  IHC-P, WB
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS2576
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P
NBP1-92328PEP
Species: Hu
Applications: AC

Publications for RGS13 Protein (NBP1-92328PEP) (0)

There are no publications for RGS13 Protein (NBP1-92328PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS13 Protein (NBP1-92328PEP) (0)

There are no reviews for RGS13 Protein (NBP1-92328PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RGS13 Protein (NBP1-92328PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS13 Products

Research Areas for RGS13 Protein (NBP1-92328PEP)

Find related products by research area.

Blogs on RGS13

There are no specific blogs for RGS13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RGS13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS13