Recombinant Human RGS12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RGS12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1095-1191 of Human RGS12 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGQRVVLEEKDPSRGKASADKQKGVPVKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RGS12
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RGS12 Protein

  • DKFZp761K1617
  • DKFZp761K1817
  • regulator of G-protein signaling 12
  • regulator of G-protein signalling 12

Background

RGS12 - regulator of G-protein signalling 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20148
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58919
Species: Hu
Applications: WB, IHC, IHC-P
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005998-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-56902
Species: Hu
Applications: WB, ICC/IF
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
NLS418
Species: Hu
Applications: IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006002-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RGS12 Partial Recombinant Protein (H00006002-Q01) (0)

There are no publications for RGS12 Partial Recombinant Protein (H00006002-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS12 Partial Recombinant Protein (H00006002-Q01) (0)

There are no reviews for RGS12 Partial Recombinant Protein (H00006002-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS12 Partial Recombinant Protein (H00006002-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS12 Products

Bioinformatics Tool for RGS12 Partial Recombinant Protein (H00006002-Q01)

Discover related pathways, diseases and genes to RGS12 Partial Recombinant Protein (H00006002-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS12 Partial Recombinant Protein (H00006002-Q01)

Discover more about diseases related to RGS12 Partial Recombinant Protein (H00006002-Q01).
 

Pathways for RGS12 Partial Recombinant Protein (H00006002-Q01)

View related products by pathway.

PTMs for RGS12 Partial Recombinant Protein (H00006002-Q01)

Learn more about PTMs related to RGS12 Partial Recombinant Protein (H00006002-Q01).
 

Research Areas for RGS12 Partial Recombinant Protein (H00006002-Q01)

Find related products by research area.

Blogs on RGS12

There are no specific blogs for RGS12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRANCE/TNFSF11/RANK L
462-TR-010/CF
RGS12 Antibody
NBP2-55755
LRPAP Antibody
NBP1-89334

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RGS12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS12