RGR Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse RGR. Peptide sequence: PVNTTLPGRMLLLGWGPYALLYLYAAIADVSFISPKLQMVPALIAKTMPT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RGR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for RGR Antibody - BSA Free
Background
Retinal G protein-coupled receptor RPE, a member of the Opsin subfamily of GPCRs has been shown to be involved in retinitis pigmentosa. It preferentially binds all-trans retinal rather than 11-cis retinal, which is normally found in rhodopsin. RPE has two isoforms produced by alternative splicing. Retinal G protein-coupled receptor RPE has been reported to be expressed in the eye. ESTs have been isolated from normal human brain and eye libraries and from human brain and colon cancer libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC-FrFl, IHC, IHC-P
Species: Pm-Cm, Hu, Mu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Rb
Applications: IHC, IHC-P
Publications for RGR Antibody (NBP2-84245) (0)
There are no publications for RGR Antibody (NBP2-84245).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RGR Antibody (NBP2-84245) (0)
There are no reviews for RGR Antibody (NBP2-84245).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RGR Antibody (NBP2-84245) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RGR Products
Research Areas for RGR Antibody (NBP2-84245)
Find related products by research area.
|
Blogs on RGR