RFC5 Recombinant Protein Antigen

Images

 
There are currently no images for RFC5 Protein (NBP1-87137PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RFC5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFC5.

Source: E. coli

Amino Acid Sequence: NYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RFC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87137.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RFC5 Recombinant Protein Antigen

  • Activator 1 36 kDa subunit
  • Activator 1 subunit 5,36.5 kD subunit
  • MGC1155
  • replication factor C (activator 1) 5, 36.5kDa
  • RF-C 36 kDa subunit
  • RFC36replication factor C (activator 1) 5 (36.5kD)

Background

The Replication factor C (RFC) heteropentamer includes RFC1, RFC2, RFC3, RFC4, and RFC5. The RFC heteropentamer is part of the multiprotein DNA replicase that functions to replicate DNA prior to cell division and repair DNA damage. RFC is the clamp loader ATPase associated with the DNA replicase. As the clamp loader, RFC uses ATP to recruit, open, and close the PCNA ring to link it to DNA for replication and repair. RFC5 is the 36kDa subunit of RFC that forms a core complex with RFC2 and RFC4 and can interact with the C-terminal region of PCNA. RFC5 is also known as replication factor C 36 kDa subunit RF-C 36 kDa subunit, RFC36, Activator 1 36 kDa subunit, A1 36 kDa subunit, and MGC1155.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF3989
Species: Hu, Mu, Rt
Applications: WB
AF6457
Species: Hu
Applications: WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-13066
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-67563
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82668
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24457
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00063922-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85525
Species: Hu
Applications: IHC,  IHC-P, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
409-ML
Species: Mu
Applications: BA
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB

Publications for RFC5 Protein (NBP1-87137PEP) (0)

There are no publications for RFC5 Protein (NBP1-87137PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC5 Protein (NBP1-87137PEP) (0)

There are no reviews for RFC5 Protein (NBP1-87137PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RFC5 Protein (NBP1-87137PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFC5 Products

Research Areas for RFC5 Protein (NBP1-87137PEP)

Find related products by research area.

Blogs on RFC5

There are no specific blogs for RFC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RFC5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC5