RFC5 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RFC5 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFC5.
  
  

  Source: E. coli

  Amino Acid Sequence: NYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RFC5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87137.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RFC5 Recombinant Protein Antigen

• Activator 1 36 kDa subunit
• Activator 1 subunit 5,36.5 kD subunit
• MGC1155
• replication factor C (activator 1) 5, 36.5kDa
• RF-C 36 kDa subunit
• RFC36replication factor C (activator 1) 5 (36.5kD)

Background

The Replication factor C (RFC) heteropentamer includes RFC1, RFC2, RFC3, RFC4, and RFC5. The RFC heteropentamer is part of the multiprotein DNA replicase that functions to replicate DNA prior to cell division and repair DNA damage. RFC is the clamp loader ATPase associated with the DNA replicase. As the clamp loader, RFC uses ATP to recruit, open, and close the PCNA ring to link it to DNA for replication and repair. RFC5 is the 36kDa subunit of RFC that forms a core complex with RFC2 and RFC4 and can interact with the C-terminal region of PCNA. RFC5 is also known as replication factor C 36 kDa subunit RF-C 36 kDa subunit, RFC36, Activator 1 36 kDa subunit, A1 36 kDa subunit, and MGC1155.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: RFC5