Home » RESF1 » RESF1 Antibodies » RESF1 Antibody

RESF1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RESF1 Antibody [NBP2-84537] - Host: Rabbit. Target Name: KIAA1551. Sample Type: ACHN Whole cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: RESF1 Antibody [NBP2-84537] - Host: Rabbit. Target Name: KIAA1551. Sample Type: ACHN Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Product Discontinued
View other related RESF1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-84537
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RESF1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C12orf35. Peptide sequence: KEQAPLQVSGIKSTKEDWLKFVATKKRTQKDSQERDNVNSRLSKRSFSAD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1551
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for RESF1 Antibody

  • C12orf35
  • chromosome 12 open reading frame 35
  • FLJ10652
  • FLJ20696
  • KIAA1551

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

beta
2-Microglobulin Antib ...
NB500-317
Western Blot beta 2-Microglobulin Antibody (B2M-01) - BSA Free
Flow Cytometry beta 2-Microglobulin Antibody (B2M-01) - BSA Free
ELISA beta 2-Microglobulin Antibody (B2M-01) - BSA Free
(1 Review)
(3 Publications)
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, RIA, WB
TDP-43/TARDBP
Antibody (2E2-D3) - A ...
H00023435-M01
Western Blot TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free
Western Blot TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free
Western Blot TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free
(3 Reviews)
(212 Publications)
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, KD, WB
SKIV2L2 Antibody
NB100-1574
Western Blot SKIV2L2 Antibody
Immunohistochemistry-Paraffin SKIV2L2 Antibody
Unknown SKIV2L2 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ICC, IHC,  IHC-P, IP, KD, WB
DYNLT1 Antibody
(SR2546)
NBP3-27809
Immunocytochemistry/ Immunofluorescence DYNLT1 Antibody (SR2546)
Immunohistochemistry-Paraffin DYNLT1 Antibody (SR2546)
Western Blot DYNLT1 Antibody (SR2546)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Actin Gamma 1
Antibody (NH3) - BSA
NB100-64792
Immunohistochemistry-Paraffin Actin Gamma 1 Antibody (NH3) - BSA Free
Western Blot Actin Gamma 1 Antibody (NH3) - BSA Free
Western Blot Actin Gamma 1 Antibody (NH3) - BSA Free
(2 Reviews)
(8 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
ILKAP/PP2C delta
Antibody - BSA Free
NBP1-85117
Immunocytochemistry/ Immunofluorescence ILKAP/PP2C delta Antibody - BSA Free
Immunohistochemistry-Paraffin ILKAP/PP2C delta Antibody - BSA Free
Immunohistochemistry-Paraffin ILKAP/PP2C delta Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
ALS Antibody
[Unconjugated]
AF1436
Western Blot ALS Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Mu
Applications: WB
SOD1/Cu-Zn SOD
Antibody - BSA Free
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody - BSA Free
Western Blot SOD1/Cu-Zn SOD Antibody - BSA Free
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody - BSA Free
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for RESF1 Antibody (NBP2-84537) (0)

There are no publications for RESF1 Antibody (NBP2-84537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RESF1 Antibody (NBP2-84537) (0)

There are no reviews for RESF1 Antibody (NBP2-84537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RESF1 Antibody (NBP2-84537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RESF1 Products

Array NBP2-84537

Blogs on RESF1

There are no specific blogs for RESF1, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RESF1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KIAA1551