RBM6 Antibody


Western Blot: RBM6 Antibody [NBP1-89376] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89376] - Staining of human colon shows distinct nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RBM6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SQSPVQDQDKSQLSGREEQSSDAGLFKEEGGLDFLGRQDTDYRSMEYRDVDHRLPGSQMFGYGQSKSFPEGKTARDAQRD
Specificity of human RBM6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RBM6 Protein (NBP1-89376PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RBM6 Antibody

  • DEF-3
  • DEF3FLJ39446,3G2
  • DKFZp686B0877
  • FLJ36517
  • FLJ42036
  • g16
  • HLC-11
  • Lung cancer antigen NY-LU-12
  • lung cancer protooncogene 11
  • NY-LU-12
  • Protein G16
  • RNA binding motif protein 6
  • RNA-binding motif protein 6
  • RNA-binding protein 6
  • RNA-binding protein DEF-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RBM6 Antibody (NBP1-89376) (0)

There are no publications for RBM6 Antibody (NBP1-89376).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM6 Antibody (NBP1-89376) (0)

There are no reviews for RBM6 Antibody (NBP1-89376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBM6 Antibody (NBP1-89376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RBM6 Products

Bioinformatics Tool for RBM6 Antibody (NBP1-89376)

Discover related pathways, diseases and genes to RBM6 Antibody (NBP1-89376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM6 Antibody (NBP1-89376)

Discover more about diseases related to RBM6 Antibody (NBP1-89376).

Pathways for RBM6 Antibody (NBP1-89376)

View related products by pathway.

PTMs for RBM6 Antibody (NBP1-89376)

Learn more about PTMs related to RBM6 Antibody (NBP1-89376).

Blogs on RBM6

There are no specific blogs for RBM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBM6 Antibody and receive a gift card or discount.


Gene Symbol RBM6