RBM23 Antibody

Images

 
Western Blot: RBM23 Antibody [NBP1-83857] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RBM23 Antibody [NBP1-83857] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: RBM23 Antibody [NBP1-83857] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM23 Protein (NBP1-83857PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM23 Antibody

  • CAPERbeta
  • FLJ10482
  • MGC4458
  • probable RNA-binding protein 23
  • RNA binding motif protein 23
  • RNA-binding motif protein 23
  • RNA-binding region (RNP1, RRM) containing 4
  • RNA-binding region-containing protein 4
  • RNPC4
  • Splicing factor SF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88200
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-90820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBM23 Antibody (NBP1-83857) (0)

There are no publications for RBM23 Antibody (NBP1-83857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM23 Antibody (NBP1-83857) (0)

There are no reviews for RBM23 Antibody (NBP1-83857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM23 Antibody (NBP1-83857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM23 Products

Bioinformatics Tool for RBM23 Antibody (NBP1-83857)

Discover related pathways, diseases and genes to RBM23 Antibody (NBP1-83857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RBM23

There are no specific blogs for RBM23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM23