RARRES1 Antibody

Images

 
Western Blot: RARRES1 Antibody [H00005918-B01P] - Analysis of RARRES1 expression in transfected 293T cell line by RARRES1 polyclonal antibody. Lane 1: RARRES1 transfected lysate(32.34 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RARRES1 Antibody Summary

Immunogen
RARRES1 (NP_996846.1, 1 a.a. - 294 a.a.) full-length human protein. MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RARRES1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RARRES1 Antibody

  • RARRES1
  • RAR-responsive protein TIG1
  • retinoic acid receptor responder (tazarotene induced) 1
  • retinoic acid receptor responder protein 1
  • TIG1
  • TIG1Tazarotene-induced gene 1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15556
Species: Hu
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
AF4885
Species: Mu
Applications: WB, IP
AF4539
Species: Hu, Mu, Rt
Applications: WB
NBP1-26616
Species: Hu
Applications: WB, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-46466
Species: Hu
Applications: IHC
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005918-B01P
Species: Hu
Applications: WB

Publications for RARRES1 Antibody (H00005918-B01P) (0)

There are no publications for RARRES1 Antibody (H00005918-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RARRES1 Antibody (H00005918-B01P) (0)

There are no reviews for RARRES1 Antibody (H00005918-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RARRES1 Antibody (H00005918-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RARRES1 Products

Bioinformatics Tool for RARRES1 Antibody (H00005918-B01P)

Discover related pathways, diseases and genes to RARRES1 Antibody (H00005918-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RARRES1 Antibody (H00005918-B01P)

Discover more about diseases related to RARRES1 Antibody (H00005918-B01P).
 

Pathways for RARRES1 Antibody (H00005918-B01P)

View related products by pathway.

PTMs for RARRES1 Antibody (H00005918-B01P)

Learn more about PTMs related to RARRES1 Antibody (H00005918-B01P).
 

Research Areas for RARRES1 Antibody (H00005918-B01P)

Find related products by research area.

Blogs on RARRES1

There are no specific blogs for RARRES1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RARRES1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARRES1
Entrez
Uniprot