RAB35 Antibody - Azide and BSA Free

Western Blot: RAB35 Antibody [NBP3-04511] - Western blot analysis of extracts of various cell lines, using RAB35 antibody (NBP3-04511) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin: RAB35 Antibody [NBP3-04511] - Immunohistochemistry of paraffin-embedded rat heart using RAB35 Rabbit pAb (NBP3-04511) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: RAB35 Antibody [NBP3-04511] - Western blot analysis of extracts of HeLa cells, using RAB35 antibody (NBP3-04511) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: RAB35 Antibody - Azide and BSA Free [RAB35] - Immunofluorescence analysis of PC-12 cells using RAB35 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Product Discontinued

RAB35 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-201 of human RAB35 (NP_006852.1). KRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB35
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for RAB35 Antibody - Azide and BSA Free

• GTP-binding protein RAY
• H-ray
• RAB1C
• RAB35, member RAS oncogene family
• ras-related protein rab-1c (GTP-binding protein ray)
• Ras-related protein Rab-1C
• ras-related protein Rab-35
• RAY

Background

Possesses GTPase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB35