| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | RAB1A (NP_004152.1, 106 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
| Specificity | RAB1A - RAB1A, member RAS oncogene family (3F10) |
| Isotype | IgM Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RAB1A |
| Purity | Unpurified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | Ascites |
| Preservative | No Preservative |
| Purity | Unpurified |
| Publications using H00005861-M07A | Applications | Species |
|---|---|---|
| Thomas JD, Zhang YJ, Wei YH et al. Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Cancer Cell. 2014-01-01 [PMID: 25446900] | ||
| Kicka S, Shen Z, Annesley SJ et al. The LRRK2-related Roco kinase Roco2 is regulated by Rab1A and controls the actin cytoskeleton. Mol Biol Cell. 2011-05-05 [PMID: 21551065] | ||
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 | ||
| Thomas JD, Zhang YJ, Wei YH et al. Rab1A Is an mTORC1 Activator and a Colorectal Oncogene. Cancer Cell 2016-08-02 [PMID: 27479033] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Rab1A Antibody (H00005861-M07A)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB1A |
| Entrez |
|
| Uniprot |
|