PTDSS1 Antibody

Images

 
Western Blot: PTDSS1 Antibody [NBP1-59966] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTDSS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PTDSS1(phosphatidylserine synthase 1) The peptide sequence was selected from the N terminal of PTDSS1. Peptide sequence MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTDSS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTDSS1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTDSS1 Antibody

  • KIAA0024Serine-exchange enzyme I
  • phosphatidylserine synthase 1
  • PSS1EC 2.7.8.-
  • PSSAPSS-1
  • PtdSer synthase 1

Background

PTDSS1 is a multi-pass membrane protein. It belongs to the phosphatidyl serine synthase family. PTDSS1 catalyzes a base-exchange reaction in which the polar head group of phosphatidylcholine is replaced by L-serine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5725
Species: Hu
Applications: WB, IHC
NBP1-80874
Species: Hu
Applications: IHC, IHC-P
NBP2-27464
Species: Hu
Applications: WB, PEP-ELISA
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-59966
Species: Hu
Applications: WB

Publications for PTDSS1 Antibody (NBP1-59966) (0)

There are no publications for PTDSS1 Antibody (NBP1-59966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTDSS1 Antibody (NBP1-59966) (0)

There are no reviews for PTDSS1 Antibody (NBP1-59966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTDSS1 Antibody (NBP1-59966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTDSS1 Products

Bioinformatics Tool for PTDSS1 Antibody (NBP1-59966)

Discover related pathways, diseases and genes to PTDSS1 Antibody (NBP1-59966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTDSS1 Antibody (NBP1-59966)

Discover more about diseases related to PTDSS1 Antibody (NBP1-59966).
 

Pathways for PTDSS1 Antibody (NBP1-59966)

View related products by pathway.

Blogs on PTDSS1

There are no specific blogs for PTDSS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTDSS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTDSS1
Uniprot