PRR32 Antibody


Immunohistochemistry-Paraffin: PRR32 Antibody [NBP2-14639] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC

Order Details

PRR32 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: SCIPLHSLRAHRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAINVSWEVSGGPPALIVGGTKVNNG
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRR32 Recombinant Protein Antigen (NBP2-14639PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PRR32 Antibody

  • CXorf64 chromosome X open reading frame 64


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for PRR32 Antibody (NBP2-14639) (0)

There are no publications for PRR32 Antibody (NBP2-14639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRR32 Antibody (NBP2-14639) (0)

There are no reviews for PRR32 Antibody (NBP2-14639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRR32 Antibody (NBP2-14639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PRR32 Products

Array NBP2-14639

Diseases for PRR32 Antibody (NBP2-14639)

Discover more about diseases related to PRR32 Antibody (NBP2-14639).

Blogs on PRR32

There are no specific blogs for PRR32, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRR32 Antibody and receive a gift card or discount.


Gene Symbol CXorf64