Protocadherin-1 Antibody (5D5)

Images

 
Western Blot: Protocadherin-1 Antibody (5D5) [H00005097-M01] - PCDH1 monoclonal antibody (M01), clone 5D5 Analysis of PCDH1 expression in A-431.
Immunocytochemistry/ Immunofluorescence: Protocadherin-1 Antibody (5D5) [H00005097-M01] - Analysis of monoclonal antibody to PCDH1 on A-431 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Protocadherin-1 Antibody (5D5) [H00005097-M01] - Analysis of monoclonal antibody to PCDH1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: Protocadherin-1 Antibody (5D5) [H00005097-M01] - Detection limit for recombinant GST tagged PCDH1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
5D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Protocadherin-1 Antibody (5D5) Summary

Immunogen
PCDH1 (NP_002578 62 a.a. - 169 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
Localization
Cell junction. Cell membrane. Single-pass type I membrane protein. Note=Found at cell-cell boundaries and probably at cell-matrix boundaries.
Specificity
PCDH1 - protocadherin 1 (cadherin-like 1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCDH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00005097-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protocadherin-1 Antibody (5D5)

  • cadherin-like 1
  • Cadherin-like protein 1
  • FLJ53887
  • MGC45991
  • PC42
  • PC42PCDH42
  • PCDH1
  • PCDH42
  • protocadherin 1 (cadherin-like 1)
  • protocadherin 1
  • protocadherin 42
  • Protocadherin1
  • Protocadherin-1
  • protocadherin-42

Background

This gene belongs to the protocadherin subfamily within the cadherin superfamily. The encoded protein is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity. Alternative splicing occurs in this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6510-CA
Species: Hu
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-46340
Species: Hu
Applications: WB, IHC, IHC-P, IF
H00005100-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
NBP2-61772
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB8364
Species: Hu
Applications: WB
NBP2-93484
Species: Hu, Mu, Rt
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00079026-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
5604-CA
Species: Hu
NBP2-94196
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
NBP1-59270
Species: Hu
Applications: WB
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for Protocadherin-1 Antibody (H00005097-M01)(2)

Reviews for Protocadherin-1 Antibody (H00005097-M01) (0)

There are no reviews for Protocadherin-1 Antibody (H00005097-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Protocadherin-1 Antibody (H00005097-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Protocadherin-1 Products

Bioinformatics Tool for Protocadherin-1 Antibody (H00005097-M01)

Discover related pathways, diseases and genes to Protocadherin-1 Antibody (H00005097-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-1 Antibody (H00005097-M01)

Discover more about diseases related to Protocadherin-1 Antibody (H00005097-M01).
 

Pathways for Protocadherin-1 Antibody (H00005097-M01)

View related products by pathway.

PTMs for Protocadherin-1 Antibody (H00005097-M01)

Learn more about PTMs related to Protocadherin-1 Antibody (H00005097-M01).

Blogs on Protocadherin-1

There are no specific blogs for Protocadherin-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin-1 Antibody (5D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH1
Entrez
OMIM
Uniprot