ProSAPiP1 Antibody

Images

 
Immunohistochemistry: ProSAPiP1 Antibody [NBP1-90918] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ProSAPiP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEFAMKSVGTRTGGGGSQGSFPGPRGSGSGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PROSAPIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ProSAPiP1 Protein (NBP1-90918PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ProSAPiP1 Antibody

  • KIAA0552
  • proline rich synapse associated protein interacting protein 1
  • proSAP-interacting protein 1
  • ProSAPiP1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47610
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7035
Species: Hu
Applications: IHC
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90482
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP1-85527
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92683
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-53816
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90918
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for ProSAPiP1 Antibody (NBP1-90918) (0)

There are no publications for ProSAPiP1 Antibody (NBP1-90918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ProSAPiP1 Antibody (NBP1-90918) (0)

There are no reviews for ProSAPiP1 Antibody (NBP1-90918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ProSAPiP1 Antibody (NBP1-90918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ProSAPiP1 Products

Bioinformatics Tool for ProSAPiP1 Antibody (NBP1-90918)

Discover related pathways, diseases and genes to ProSAPiP1 Antibody (NBP1-90918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ProSAPiP1 Antibody (NBP1-90918)

Discover more about diseases related to ProSAPiP1 Antibody (NBP1-90918).
 

Pathways for ProSAPiP1 Antibody (NBP1-90918)

View related products by pathway.

Blogs on ProSAPiP1

There are no specific blogs for ProSAPiP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ProSAPiP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PROSAPIP1