Proprotein convertase PC4 Antibody


Western Blot: Proprotein convertase PC4 Antibody [NBP1-55224] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Proprotein convertase PC4 Antibody Summary

Synthetic peptides corresponding to PCSK4(proprotein convertase subtilisin/kexin type 4) The peptide sequence was selected from the N terminal of PCSK4. Peptide sequence VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCSK4 and was validated on Western blot.
Theoretical MW
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Proprotein convertase PC4 Antibody

  • DKFZp434B217
  • EC 3.4.21
  • EC
  • EC
  • MGC34749
  • PC4EC 3.4.21.-
  • Proprotein convertase 4
  • proprotein convertase subtilisin/kexin type 4
  • SPC5


PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR; MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 AC027307.5 80201-80231 c 32-257 AY358963.1 32-257 258-655 AK057235.1 452-849 656-2528 AY358963.1 656-2528 2529-2606 AL043305.1 210-287 2607-2674 AA453604.1 1-68 c


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Mu
Applications: WB
Species: Hu

Publications for Proprotein convertase PC4 Antibody (NBP1-55224) (0)

There are no publications for Proprotein convertase PC4 Antibody (NBP1-55224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proprotein convertase PC4 Antibody (NBP1-55224) (0)

There are no reviews for Proprotein convertase PC4 Antibody (NBP1-55224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proprotein convertase PC4 Antibody (NBP1-55224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Proprotein convertase PC4 Products

Bioinformatics Tool for Proprotein convertase PC4 Antibody (NBP1-55224)

Discover related pathways, diseases and genes to Proprotein convertase PC4 Antibody (NBP1-55224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proprotein convertase PC4 Antibody (NBP1-55224)

Discover more about diseases related to Proprotein convertase PC4 Antibody (NBP1-55224).

Pathways for Proprotein convertase PC4 Antibody (NBP1-55224)

View related products by pathway.

PTMs for Proprotein convertase PC4 Antibody (NBP1-55224)

Learn more about PTMs related to Proprotein convertase PC4 Antibody (NBP1-55224).

Blogs on Proprotein convertase PC4

There are no specific blogs for Proprotein convertase PC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proprotein convertase PC4 Antibody and receive a gift card or discount.


Gene Symbol PCSK4