PRKX Antibody (1H7) - Azide and BSA Free

Western Blot: PRKX Antibody (1H7) [H00005613-M01] - Analysis of PRKX expression in transfected 293T cell line by PRKX monoclonal antibody (M01), clone 1H7.Lane 1: PRKX transfected lysate(40.9 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: PRKX Antibody (1H7) [H00005613-M01] - Analysis of PRKX transfected lysate using anti-PRKX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRKX MaxPab rabbit polyclonal antibody.

Sandwich ELISA: PRKX Antibody (1H7) [H00005613-M01] - Detection limit for recombinant GST tagged PRKX is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 1H7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PRKX Antibody (1H7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PRKX (AAH41073, 269 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
• Specificity: PRKX - protein kinase, X-linked (1H7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PRKX
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRKX Antibody (1H7) - Azide and BSA Free

• EC 2.7.11
• PKX1
• PKX1EC 2.7.11.1
• PRKX
• Protein kinase PKX1
• Protein kinase X
• protein kinase, X-linked
• serine/threonine-protein kinase PRKX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKX
• Entrez:
  • 5613(Human)
• Uniprot:
  • AAH41073(Human)