PRDM11 Antibody

Images

 
Immunohistochemistry: PRDM11 Antibody [NBP2-30650] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QVDFWFCESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRDM11 Protein (NBP2-30650PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRDM11 Antibody

  • PFM8PR domain-containing protein 11
  • PR domain containing 11
  • PR-domain containing protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3838
Species: Rt
Applications: WB, IHC
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP2-30650
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PRDM11 Antibody (NBP2-30650) (0)

There are no publications for PRDM11 Antibody (NBP2-30650).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM11 Antibody (NBP2-30650) (0)

There are no reviews for PRDM11 Antibody (NBP2-30650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRDM11 Antibody (NBP2-30650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM11 Products

PRDM11 NBP2-30650

Bioinformatics Tool for PRDM11 Antibody (NBP2-30650)

Discover related pathways, diseases and genes to PRDM11 Antibody (NBP2-30650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRDM11

There are no specific blogs for PRDM11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM11
Uniprot