Recombinant Human POU4F3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POU4F3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 100 - 190 of Human POU4F3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POU4F3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POU4F3 Protein

  • brain-3C
  • Brain-specific homeobox/POU domain protein 3C
  • BRN3.1
  • Brn-3C
  • BRN3Cbrn-3C
  • DFNA15
  • MGC138412
  • POU class 4 homeobox 3
  • POU domain class 4, transcription factor 3
  • POU domain, class 4, transcription factor 3

Background

POU4F3 - POU domain, class 4, transcription factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005457-M04
Species: Hu
Applications: WB, ELISA
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-31318
Species: Mu
Applications: IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB600-230
Species: Hu
Applications: WB
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP1-31318
Species: Mu
Applications: IHC-P
38160002
Species: Hu
Applications: WB, ELISA
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-86513
Species: Hu
Applications: IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00005459-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POU4F3 Partial Recombinant Protein (H00005459-Q01) (0)

There are no publications for POU4F3 Partial Recombinant Protein (H00005459-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU4F3 Partial Recombinant Protein (H00005459-Q01) (0)

There are no reviews for POU4F3 Partial Recombinant Protein (H00005459-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU4F3 Partial Recombinant Protein (H00005459-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POU4F3 Products

Bioinformatics Tool for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Discover related pathways, diseases and genes to POU4F3 Partial Recombinant Protein (H00005459-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Discover more about diseases related to POU4F3 Partial Recombinant Protein (H00005459-Q01).
 

Pathways for POU4F3 Partial Recombinant Protein (H00005459-Q01)

View related products by pathway.

PTMs for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Learn more about PTMs related to POU4F3 Partial Recombinant Protein (H00005459-Q01).
 

Research Areas for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Find related products by research area.

Blogs on POU4F3

There are no specific blogs for POU4F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
POU4F3 Antibody
NBP1-88349

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POU4F3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU4F3