Recombinant Human POU4F3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human POU4F3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 100-190 of Human POU4F3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
POU4F3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POU4F3 GST (N-Term) Protein

  • brain-3C
  • Brain-specific homeobox/POU domain protein 3C
  • BRN3.1
  • Brn-3C
  • BRN3Cbrn-3C
  • DFNA15
  • MGC138412
  • POU class 4 homeobox 3
  • POU domain class 4, transcription factor 3
  • POU domain, class 4, transcription factor 3

Background

POU4F3 - POU domain, class 4, transcription factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005457-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-26061
Species: Bv, Ca, Hu, Mu, Rt
Applications: PEP-ELISA, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
NBP1-45693
Species: Hu, Mu, Rt
Applications: IHC, WB
267-N3/CF
Species: Hu
Applications: BA
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
AF3540
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-45693
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00007007-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP1-86513
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for POU4F3 Partial Recombinant Protein (H00005459-Q01) (0)

There are no publications for POU4F3 Partial Recombinant Protein (H00005459-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU4F3 Partial Recombinant Protein (H00005459-Q01) (0)

There are no reviews for POU4F3 Partial Recombinant Protein (H00005459-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU4F3 Partial Recombinant Protein (H00005459-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POU4F3 Products

Bioinformatics Tool for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Discover related pathways, diseases and genes to POU4F3 Partial Recombinant Protein (H00005459-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Discover more about diseases related to POU4F3 Partial Recombinant Protein (H00005459-Q01).
 

Pathways for POU4F3 Partial Recombinant Protein (H00005459-Q01)

View related products by pathway.

PTMs for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Learn more about PTMs related to POU4F3 Partial Recombinant Protein (H00005459-Q01).
 

Research Areas for POU4F3 Partial Recombinant Protein (H00005459-Q01)

Find related products by research area.

Blogs on POU4F3

There are no specific blogs for POU4F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POU4F3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU4F3