Recombinant Human PLEKHG5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLEKHG5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 896-995 of Human PLEKHG5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL

Protein/Peptide Type
Partial Recombinant Protein
Gene
PLEKHG5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLEKHG5 Protein

  • CMTRIC
  • DSMA4
  • GEF720
  • KIAA0720Guanine nucleotide exchange factor 720
  • NFkB activating protein
  • novel PH domain-containing protein
  • PH domain-containing family G member 5
  • pleckstrin homology domain containing family G member 5
  • pleckstrin homology domain containing, family G (with RhoGef domain) member 5
  • pleckstrin homology domain-containing family G member 5
  • Syx
  • Tech

Background

PLEKHG5 - pleckstrin homology domain containing, family G (with RhoGef domain) member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
H00154796-B01P
Species: Hu, Rt
Applications: WB, ELISA
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
MAB6618
Species: Hu, Mu
Applications: WB
NBP1-32311
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-58844
Species: Hu
Applications: ICC/IF
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03000
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-85130
Species: Hu
Applications: WB, IHC, IHC-P
H00057449-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PLEKHG5 Partial Recombinant Protein (H00057449-Q01) (0)

There are no publications for PLEKHG5 Partial Recombinant Protein (H00057449-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHG5 Partial Recombinant Protein (H00057449-Q01) (0)

There are no reviews for PLEKHG5 Partial Recombinant Protein (H00057449-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHG5 Partial Recombinant Protein (H00057449-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLEKHG5 Products

Bioinformatics Tool for PLEKHG5 Partial Recombinant Protein (H00057449-Q01)

Discover related pathways, diseases and genes to PLEKHG5 Partial Recombinant Protein (H00057449-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHG5 Partial Recombinant Protein (H00057449-Q01)

Discover more about diseases related to PLEKHG5 Partial Recombinant Protein (H00057449-Q01).
 

Pathways for PLEKHG5 Partial Recombinant Protein (H00057449-Q01)

View related products by pathway.

PTMs for PLEKHG5 Partial Recombinant Protein (H00057449-Q01)

Learn more about PTMs related to PLEKHG5 Partial Recombinant Protein (H00057449-Q01).
 

Research Areas for PLEKHG5 Partial Recombinant Protein (H00057449-Q01)

Find related products by research area.

Blogs on PLEKHG5

There are no specific blogs for PLEKHG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RhoA Antibody
NB100-91273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLEKHG5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHG5