Recombinant Human PLEKHG5 Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, AP

Recombinant Human PLEKHG5 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 896-995 of Human PLEKHG5
  
  

  Source: Wheat Germ

  Amino Acid Sequence: SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: PLEKHG5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Application Notes: This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLEKHG5 Protein

• CMTRIC
• DSMA4
• GEF720
• KIAA0720Guanine nucleotide exchange factor 720
• NFkB activating protein
• novel PH domain-containing protein
• PH domain-containing family G member 5
• pleckstrin homology domain containing family G member 5
• pleckstrin homology domain containing, family G (with RhoGef domain) member 5
• pleckstrin homology domain-containing family G member 5
• Syx
• Tech

Background

PLEKHG5 - pleckstrin homology domain containing, family G (with RhoGef domain) member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PLEKHG5