PLA2G4A Recombinant Protein Antigen

Images

 
There are currently no images for PLA2G4A Protein (NBP2-38616PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PLA2G4A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLA2G4A.

Source: E. coli

Amino Acid Sequence: TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLA2G4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38616.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLA2G4A Recombinant Protein Antigen

  • calcium-dependent phospholipid-binding protein
  • cPLA2
  • cPLA2-alpha
  • lysophospholipase
  • MGC126350
  • phosphatidylcholine 2-acylhydrolase
  • Phospholipase A2 group IVA
  • phospholipase A2, group IVA (cytosolic, calcium-dependent)
  • PLA2G4A
  • PLA2G4cytosolic phospholipase A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00151056-B01P
Species: Hu, Mu
Applications: WB
MAB5018
Species: Hu
Applications: IP, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
NBP3-46465
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
5255-EN
Species: Hu
Applications: EnzAct
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP3-41287
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for PLA2G4A Protein (NBP2-38616PEP) (0)

There are no publications for PLA2G4A Protein (NBP2-38616PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G4A Protein (NBP2-38616PEP) (0)

There are no reviews for PLA2G4A Protein (NBP2-38616PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLA2G4A Protein (NBP2-38616PEP). (Showing 1 - 1 of 1 FAQ).

  1. Hi. Actually I want to purchase anti cPLA2 antibody raised in rabbit which can bind to both phorphorylated and unphosphorylated mouse cPLA2 group IV. I want to a gel shift assay with western blotting to show that my protein of interest is causing the phosphorylation of cPLA2 inside the mouse macrophages RAW cells.Can you please tell me which antibody would be suitable for the purpose. Thanks a lot.
    • Here are our antibodies raised in rabbit that have been validated to detect cPLA2 in mouse samples in a western blot. We have not specifically confirmed the ability of these antibodies to detect both the phosphorylated and unphosphorylated forms of the protein, and I cannot guarantee that they will clearly differentiate between the two.

Additional PLA2G4A Products

Research Areas for PLA2G4A Protein (NBP2-38616PEP)

Find related products by research area.

Blogs on PLA2G4A

There are no specific blogs for PLA2G4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLA2G4A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G4A