PIP5KL1 Antibody - BSA Free

Western Blot: PIP5KL1 Antibody [NBP2-88054] - WB Suggested Anti-PIP5KL1 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PIP5KL1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of PIP5KL1. Peptide sequence: LGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHEDERGPGSSLIFR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIP5KL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PIP5KL1 Antibody - BSA Free

• bA203J24.5
• EC 2.7.1.68
• MGC46424
• phosphatidylinositol phosphate kinase homolog
• phosphatidylinositol-4-phosphate 5-kinase-like 1
• phosphatidylinositol-4-phosphate 5-kinase-like protein 1
• PI(4)P 5-kinase-like protein 1
• PIPKH
• PtdIns(4)P-5-kinase-like protein 1

Background

PIP5KL1 is a phosphoinositide kinase-like protein that lacks intrinsic lipid kinase activity but associates with type IPIPKs (see PIP5K1A; MIM 603275) and may play a role in localization of PIPK activity (Chang et al., 2004 (PubMed14701839)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIP5KL1