PIP5KL1 Antibody


Western Blot: PIP5KL1 Antibody [NBP1-52922] - Titration: 0.2-1 ug/ml Positive Control: Human Lung.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PIP5KL1 Antibody Summary

Synthetic peptides corresponding to PIP5KL1(phosphatidylinositol-4-phosphate 5-kinase-like 1) The peptide sequence was selected from the middle region of PIP5KL1. Peptide sequence VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PIP5KL1 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIP5KL1 Antibody

  • bA203J24.5
  • EC
  • MGC46424
  • phosphatidylinositol phosphate kinase homolog
  • phosphatidylinositol-4-phosphate 5-kinase-like 1
  • phosphatidylinositol-4-phosphate 5-kinase-like protein 1
  • PI(4)P 5-kinase-like protein 1
  • PtdIns(4)P-5-kinase-like protein 1


PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB

Publications for PIP5KL1 Antibody (NBP1-52922) (0)

There are no publications for PIP5KL1 Antibody (NBP1-52922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIP5KL1 Antibody (NBP1-52922) (0)

There are no reviews for PIP5KL1 Antibody (NBP1-52922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIP5KL1 Antibody (NBP1-52922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PIP5KL1 Products

Bioinformatics Tool for PIP5KL1 Antibody (NBP1-52922)

Discover related pathways, diseases and genes to PIP5KL1 Antibody (NBP1-52922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIP5KL1 Antibody (NBP1-52922)

Discover more about diseases related to PIP5KL1 Antibody (NBP1-52922).

Pathways for PIP5KL1 Antibody (NBP1-52922)

View related products by pathway.

PTMs for PIP5KL1 Antibody (NBP1-52922)

Learn more about PTMs related to PIP5KL1 Antibody (NBP1-52922).

Research Areas for PIP5KL1 Antibody (NBP1-52922)

Find related products by research area.

Blogs on PIP5KL1

There are no specific blogs for PIP5KL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIP5KL1 Antibody and receive a gift card or discount.


Gene Symbol PIP5KL1