Recombinant Human PIP5K1 alpha Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIP5K1 alpha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 258-347 of Human PIP5K1A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIP5K1A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIP5K1 alpha Protein

  • 68 kDa type I phosphatidylinositol-4-phosphate 5-kinase alpha
  • EC 2.7.1
  • EC 2.7.1.68
  • Phosphatidylinositol-4-phosphate 5-kinase type I alpha
  • phosphatidylinositol-4-phosphate 5-kinase type-1 alpha
  • phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
  • PIP5K1-alpha
  • PIP5KIalpha
  • PtdIns(4)P-5-kinase 1 alpha

Background

PIP5K1A - phosphatidylinositol-4-phosphate 5-kinase, type I, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
H00266971-P01
Species: Hu
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92272
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2318
Species: Hu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03492
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
AF6526
Species: Hu
Applications: WB
NBP2-13918
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01) (0)

There are no publications for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01) (0)

There are no reviews for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIP5K1 alpha Products

Bioinformatics Tool for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01)

Discover related pathways, diseases and genes to PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01)

Discover more about diseases related to PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01).
 

Pathways for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01)

View related products by pathway.

PTMs for PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01)

Learn more about PTMs related to PIP5K1 alpha Partial Recombinant Protein (H00008394-Q01).

Blogs on PIP5K1 alpha

There are no specific blogs for PIP5K1 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIP5K1 alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIP5K1A