Pin1 Antibody (2F2)

Images

 
Western Blot: Pin1 Antibody (2F2) [H00005300-M01] - PIN1 monoclonal antibody (M01), clone 2F2 Analysis of PIN1 expression in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pin1 Antibody (2F2) Summary

Immunogen
PIN1 (AAH02899 64 a.a. - 163 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Specificity
PIN1 - protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pin1 Antibody (2F2)

  • dod
  • EC 5.2.1.8
  • peptidylprolyl cis/trans isomerase, NIMA-interacting 1
  • peptidyl-prolyl cis/trans isomerase, NIMA-interacting
  • peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
  • Peptidyl-prolyl cis-trans isomerase Pin1
  • Pin1
  • PPIase Pin1
  • prolyl isomerase
  • protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1
  • protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1
  • Rotamase Pin1
  • UBL5

Background

The human PIN1 gene encodes an essential nuclear peptidylprolyl cis-trans isomerase (PPIase; EC 5.2.1.8) involved in regulation of mitosis. PIN1 belongs to a class of PPIases that includes the E. coli parvulin, yeast Ess1, and Drosophila dodo (dod) gene products (Lu et al., 1996 [PubMed 8606777]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46420
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP

Publications for Pin1 Antibody (H00005300-M01) (0)

There are no publications for Pin1 Antibody (H00005300-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pin1 Antibody (H00005300-M01) (0)

There are no reviews for Pin1 Antibody (H00005300-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pin1 Antibody (H00005300-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pin1 Products

Bioinformatics Tool for Pin1 Antibody (H00005300-M01)

Discover related pathways, diseases and genes to Pin1 Antibody (H00005300-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pin1 Antibody (H00005300-M01)

Discover more about diseases related to Pin1 Antibody (H00005300-M01).
 

Pathways for Pin1 Antibody (H00005300-M01)

View related products by pathway.

PTMs for Pin1 Antibody (H00005300-M01)

Learn more about PTMs related to Pin1 Antibody (H00005300-M01).
 

Research Areas for Pin1 Antibody (H00005300-M01)

Find related products by research area.

Blogs on Pin1

There are no specific blogs for Pin1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pin1 Antibody (2F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIN1
Entrez
OMIM
Uniprot