Phospholipase A2 XII Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Phospholipase A2 XII Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-38272PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Phospholipase A2 XII Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLA2G12A.

Source: E. coli

Amino Acid Sequence: CQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLA2G12A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38272.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Phospholipase A2 XII Recombinant Protein Antigen

  • EC 3.1.1.4
  • group XII secreted phospholipase A2
  • group XIIA secreted phospholipase A2
  • group XIIA secretory phospholipase A2
  • GXII sPLA2
  • GXII
  • Phosphatidylcholine 2-acylhydrolase 12A
  • phospholipase A2, group XII
  • phospholipase A2, group XIIA
  • PLA2G12
  • ROSSY
  • sPLA2-XII

Background

Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-41287
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31685
Species: Hu
Applications: IHC,  IHC-P
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-94062
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1657
Species: Mu
Applications: WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-50248
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31558
Species: Hu
Applications: IHC,  IHC-P
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, RIA, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
1290-IL
Species: Hu
Applications: BA
NBP1-83367
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB

Publications for Phospholipase A2 XII Protein (NBP2-38272PEP) (0)

There are no publications for Phospholipase A2 XII Protein (NBP2-38272PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase A2 XII Protein (NBP2-38272PEP) (0)

There are no reviews for Phospholipase A2 XII Protein (NBP2-38272PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Phospholipase A2 XII Protein (NBP2-38272PEP). (Showing 1 - 2 of 2 FAQ).

  1. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies?
    • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.
  2. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies recognize other phospholipases?
    • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

Additional Phospholipase A2 XII Products

Research Areas for Phospholipase A2 XII Protein (NBP2-38272PEP)

Find related products by research area.

Blogs on Phospholipase A2 XII

There are no specific blogs for Phospholipase A2 XII, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Phospholipase A2 XII Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G12A