Phospholipase A2 XII Antibody (1D11) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Phospholipase A2 XII Antibody (1D11) - Azide and BSA Free (H00081579-M01) is a monoclonal antibody validated for use in IHC, WB and ELISA. Anti-Phospholipase A2 XII Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
PLA2G12A (NP_110448, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD |
| Localization |
Secreted |
| Specificity |
PLA2G12A - phospholipase A2, group XIIA |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
PLA2G12A |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Publications |
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Phospholipase A2 XII Antibody (1D11) - Azide and BSA Free
Background
Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Publications for Phospholipase A2 XII Antibody (H00081579-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for Phospholipase A2 XII Antibody (H00081579-M01) (0)
There are no reviews for Phospholipase A2 XII Antibody (H00081579-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Phospholipase A2 XII Antibody (H00081579-M01). (Showing 1 - 2 of 2 FAQ).
-
Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies?
- Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.
-
Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies recognize other phospholipases?
- Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.
Secondary Antibodies
| |
Isotype Controls
|
Additional Phospholipase A2 XII Products
Research Areas for Phospholipase A2 XII Antibody (H00081579-M01)
Find related products by research area.
|
Blogs on Phospholipase A2 XII