PDE7B Antibody


Western Blot: PDE7B Antibody [NBP1-52979] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PDE7B Antibody Summary

Synthetic peptides corresponding to PDE7B(phosphodiesterase 7B) The peptide sequence was selected from the middle region of PDE7B. Peptide sequence IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDE7B and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDE7B Antibody

  • bA472E5.1
  • cAMP-specific 3'-5'-cyclic phosphodiesterase 7B
  • EC 3.1.4
  • EC
  • high-affinity cAMP-specific 3'-5'-cyclic phosphodiesterase
  • MGC88256
  • phosphodiesterase 7B
  • rolipram-insensitive phosphodiesterase type 7


The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB

Publications for PDE7B Antibody (NBP1-52979) (0)

There are no publications for PDE7B Antibody (NBP1-52979).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE7B Antibody (NBP1-52979) (0)

There are no reviews for PDE7B Antibody (NBP1-52979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE7B Antibody (NBP1-52979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PDE7B Products

Bioinformatics Tool for PDE7B Antibody (NBP1-52979)

Discover related pathways, diseases and genes to PDE7B Antibody (NBP1-52979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE7B Antibody (NBP1-52979)

Discover more about diseases related to PDE7B Antibody (NBP1-52979).

Pathways for PDE7B Antibody (NBP1-52979)

View related products by pathway.

PTMs for PDE7B Antibody (NBP1-52979)

Learn more about PTMs related to PDE7B Antibody (NBP1-52979).

Research Areas for PDE7B Antibody (NBP1-52979)

Find related products by research area.

Blogs on PDE7B

There are no specific blogs for PDE7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PDE7B Antibody and receive a gift card or discount.


Gene Symbol PDE7B