Recombinant Human PDE4B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PDE4B GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 637-736 of Human PDE4B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PDE4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PDE4B GST (N-Term) Protein

  • cAMP-specific (phosphodiesterase E4 dunce homolog
  • cAMP-specific 3'-5'-cyclic phosphodiesterase 4B
  • cAMP-specific phosphodiesterase-4 B isoform
  • DKFZp686F2182
  • DPDE4
  • Drosophila)
  • dunce-like phosphodiesterase E4
  • EC 3.1.4
  • EC 3.1.4.17
  • MGC126529
  • PDE32
  • PDE4B
  • PDEIVB
  • phosphodiesterase 4B, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E4)
  • phosphodiesterase 4B, cAMP-specific (dunce
  • phosphodiesterase 4B, cAMP-specific
  • phosphodiesterase E4 dunce homolog

Background

PDE4B - phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02559
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-2462
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, PEP-ELISA, WB
NBP1-88908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-12244
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP3-12242
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85645
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-639
Species: Hu, Mu, Rt
Applications: IP, WB
NBP2-01086
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37404
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

Publications for PDE4B Partial Recombinant Protein (H00005142-Q01) (0)

There are no publications for PDE4B Partial Recombinant Protein (H00005142-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE4B Partial Recombinant Protein (H00005142-Q01) (0)

There are no reviews for PDE4B Partial Recombinant Protein (H00005142-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE4B Partial Recombinant Protein (H00005142-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDE4B Products

Bioinformatics Tool for PDE4B Partial Recombinant Protein (H00005142-Q01)

Discover related pathways, diseases and genes to PDE4B Partial Recombinant Protein (H00005142-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE4B Partial Recombinant Protein (H00005142-Q01)

Discover more about diseases related to PDE4B Partial Recombinant Protein (H00005142-Q01).
 

Pathways for PDE4B Partial Recombinant Protein (H00005142-Q01)

View related products by pathway.

PTMs for PDE4B Partial Recombinant Protein (H00005142-Q01)

Learn more about PTMs related to PDE4B Partial Recombinant Protein (H00005142-Q01).
 

Research Areas for PDE4B Partial Recombinant Protein (H00005142-Q01)

Find related products by research area.

Blogs on PDE4B

There are no specific blogs for PDE4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PDE4B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE4B