Recombinant Human PDE3A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PDE3A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 533 - 640 of Human PDE3A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PDE3A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PDE3A Protein

  • CGI-PDE A
  • CGI-PDE
  • cGMP-inhibited 3'-5'-cyclic phosphodiesterase A
  • cyclic GMP inhibited phosphodiesterase A
  • Cyclic GMP-inhibited phosphodiesterase A
  • EC 3.1.4
  • EC 3.1.4.17
  • phosphodiesterase 3A, cGMP-inhibited

Background

PDE3A - phosphodiesterase 3A, cGMP-inhibited

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46183
Species: Hu
Applications: WB, IP
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46355
Species: Hu
Applications: WB, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
NBP1-83160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for PDE3A Partial Recombinant Protein (H00005139-Q01) (0)

There are no publications for PDE3A Partial Recombinant Protein (H00005139-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE3A Partial Recombinant Protein (H00005139-Q01) (0)

There are no reviews for PDE3A Partial Recombinant Protein (H00005139-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE3A Partial Recombinant Protein (H00005139-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDE3A Products

Bioinformatics Tool for PDE3A Partial Recombinant Protein (H00005139-Q01)

Discover related pathways, diseases and genes to PDE3A Partial Recombinant Protein (H00005139-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE3A Partial Recombinant Protein (H00005139-Q01)

Discover more about diseases related to PDE3A Partial Recombinant Protein (H00005139-Q01).
 

Pathways for PDE3A Partial Recombinant Protein (H00005139-Q01)

View related products by pathway.

PTMs for PDE3A Partial Recombinant Protein (H00005139-Q01)

Learn more about PTMs related to PDE3A Partial Recombinant Protein (H00005139-Q01).
 

Research Areas for PDE3A Partial Recombinant Protein (H00005139-Q01)

Find related products by research area.

Blogs on PDE3A

There are no specific blogs for PDE3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PDE3A Antibody
NBP1-85645

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PDE3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE3A