Recombinant Human PDE3A GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 533-640 of Human PDE3A Source: Wheat Germ (in vitro) Amino Acid Sequence: TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Partial Recombinant Protein |
Gene |
PDE3A |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Theoretical MW |
37.62 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human PDE3A GST (N-Term) Protein
Background
PDE3A - phosphodiesterase 3A, cGMP-inhibited
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bt, Bv, Ca, Pm, Pm, Rb, Xp
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Publications for PDE3A Partial Recombinant Protein (H00005139-Q01) (0)
There are no publications for PDE3A Partial Recombinant Protein (H00005139-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PDE3A Partial Recombinant Protein (H00005139-Q01) (0)
There are no reviews for PDE3A Partial Recombinant Protein (H00005139-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PDE3A Partial Recombinant Protein (H00005139-Q01) (0)
Other Available Formats
Additional PDE3A Products
Bioinformatics Tool for PDE3A Partial Recombinant Protein (H00005139-Q01)
Discover related pathways, diseases and genes to PDE3A Partial Recombinant Protein (H00005139-Q01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PDE3A Partial Recombinant Protein (H00005139-Q01)
Discover more about diseases related to PDE3A Partial Recombinant Protein (H00005139-Q01).
| | Pathways for PDE3A Partial Recombinant Protein (H00005139-Q01)
View related products by pathway.
|
PTMs for PDE3A Partial Recombinant Protein (H00005139-Q01)
Learn more about PTMs related to PDE3A Partial Recombinant Protein (H00005139-Q01).
| | Research Areas for PDE3A Partial Recombinant Protein (H00005139-Q01)
Find related products by research area.
|
Blogs on PDE3A