Recombinant Human PCDHB5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCDHB5 Protein Summary

Description
PCDHB5 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VVVVSARDLDAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIVATDGGGLSGKCTVAIEVVDVNDNAPELTMSTLSSPTPE
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDHB5

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCDHB5 Protein

  • DKFZp586B0217
  • PCDH-BETA5
  • PCDH-beta-5
  • protocadherin beta 5
  • protocadherin beta-5

Background

PCDHB5 - protocadherin beta 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-86039
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB2240
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-39493
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30954
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00026167-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PCDHB5 Partial Recombinant Protein (H00026167-Q01) (0)

There are no publications for PCDHB5 Partial Recombinant Protein (H00026167-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHB5 Partial Recombinant Protein (H00026167-Q01) (0)

There are no reviews for PCDHB5 Partial Recombinant Protein (H00026167-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHB5 Partial Recombinant Protein (H00026167-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human PCDHB5 Protein Products

Related Products by Gene

Bioinformatics Tool for PCDHB5 Partial Recombinant Protein (H00026167-Q01)

Discover related pathways, diseases and genes to PCDHB5 Partial Recombinant Protein (H00026167-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDHB5 Partial Recombinant Protein (H00026167-Q01)

Discover more about diseases related to PCDHB5 Partial Recombinant Protein (H00026167-Q01).

Blogs on PCDHB5

There are no specific blogs for PCDHB5, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human PCDHB5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHB5

Customers Who Bought This Also Bought

PCDHB5 Antibody
NBP1-84144
PCDHB5 Antibody
NBP1-84144
MYL4 Antibody
NBP2-30954
MYL4 Antibody
NBP2-30954
MYL4 Antibody
NBP2-30954