Recombinant Human PCDHB5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PCDHB5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 261-357 of Human PCDHB5

Source: Wheat Germ

Amino Acid Sequence: VVVVSARDLDAGAYGSVAYALFQGDEVTQPFVIDEKTAEIRLKRALDFEATPYYNVEIVATDGGGLSGKCTVAIEVVDVNDNAPELTMSTLSSPTPE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCDHB5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCDHB5 Protein

  • DKFZp586B0217
  • PCDH-BETA5
  • PCDH-beta-5
  • protocadherin beta 5
  • protocadherin beta-5

Background

PCDHB5 - protocadherin beta 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77040
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-86039
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2240
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-59317
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00026167-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PCDHB5 Partial Recombinant Protein (H00026167-Q01) (0)

There are no publications for PCDHB5 Partial Recombinant Protein (H00026167-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHB5 Partial Recombinant Protein (H00026167-Q01) (0)

There are no reviews for PCDHB5 Partial Recombinant Protein (H00026167-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDHB5 Partial Recombinant Protein (H00026167-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCDHB5 Products

Bioinformatics Tool for PCDHB5 Partial Recombinant Protein (H00026167-Q01)

Discover related pathways, diseases and genes to PCDHB5 Partial Recombinant Protein (H00026167-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDHB5 Partial Recombinant Protein (H00026167-Q01)

Discover more about diseases related to PCDHB5 Partial Recombinant Protein (H00026167-Q01).

Blogs on PCDHB5

There are no specific blogs for PCDHB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PCDHB5 Antibody
NBP1-84144
MYL4 Antibody
NBP2-30954

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCDHB5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHB5