PCBP3 Antibody

Images

 
Western Blot: PCBP3 Antibody [NBP1-89505] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PCBP3 Antibody [NBP1-89505] - Staining of human duodenum shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCBP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCBP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PCBP3 Protein (NBP1-89505PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-89505 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCBP3 Antibody

  • Alpha-CP3
  • poly (rC)-binding protein 310ALPHA-CP3
  • poly(rC) binding protein 3
  • poly(rC)-binding protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-58170
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCBP3 Antibody (NBP1-89505) (0)

There are no publications for PCBP3 Antibody (NBP1-89505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCBP3 Antibody (NBP1-89505) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.
We have 2 reviews tested in 2 application: ICC, WB.

Reviews using NBP1-89505:
Filter by Applications
ICC
(1)
WB
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry PCBP3 NBP1-89505
Enlarge
reviewed by:
Anonymous
ICC Human 11/18/2017
View

Summary

ApplicationImmunocytochemistry
Sample Tested fibroblasts
SpeciesHuman
LotR29091

Comments

Comments1X PBS/5% normal serum/0.3% Triton™ X-100
Diluted 1:100 in 1X PBS/1% BSA/0.3% Triton™ X-100, 16 hours at 4C incubation.
Western Blot PCBP3 NBP1-89505
Enlarge
reviewed by:
Anonymous
WB Human 08/18/2017
View

Summary

ApplicationWestern Blot
Sample TestedFibroblast whole cell lysate
SpeciesHuman
LotR29091

Comments

Comments30ug of protein. 4-12% Bis-Tris Gel. Incubated o/n 4C in primary 1:250 dilution.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCBP3 Antibody (NBP1-89505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCBP3 Products

Bioinformatics Tool for PCBP3 Antibody (NBP1-89505)

Discover related pathways, diseases and genes to PCBP3 Antibody (NBP1-89505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCBP3 Antibody (NBP1-89505)

Discover more about diseases related to PCBP3 Antibody (NBP1-89505).
 

Pathways for PCBP3 Antibody (NBP1-89505)

View related products by pathway.

Blogs on PCBP3

There are no specific blogs for PCBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Anonymous
11/18/2017
Application: ICC
Species: Human

Anonymous
08/18/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol PCBP3