![Sandwich ELISA: Pannexin-1 Antibody (2E3) [H00024145-M07] - Detection limit for recombinant GST tagged PANX1 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Pannexin-1-Antibody-2E3-Sandwich-ELISA-H00024145-M07-img0001.jpg "Sandwich ELISA: Pannexin-1 Antibody (2E3) [H00024145-M07] - Detection limit for recombinant GST tagged PANX1 is 1 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2E3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | PANX1 (NP_056183.2, 327 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSS |
| Specificity | PANX1 - pannexin 1 (2E3) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PANX1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00024145-M07 | Applications | Species |
|---|---|---|
| Derangere V, Chevriaux A, Courtaut F et al. Liver X receptor beta activation induces pyroptosis of human and murine colon cancer cells. Cell Death Differ. 2014-12-01 [PMID: 25124554] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Pannexin-1 Antibody (H00024145-M07)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PANX1 |
| Entrez |
|
| Uniprot |
|
![IL-18/IL-1F4 [HRP]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-18/IL-1F4 [HRP]")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
