p38 beta/MAPK11 Antibody

Images

 
Western Blot: p38 beta/MAPK11 Antibody [H00005600-B01P] - Analysis of MAPK11 expression in transfected 293T cell line by MAPK11 polyclonal antibody. Lane 1: MAPK11 transfected lysate(40.04 KDa). Lane 2: Non-transfected ...read more
Immunocytochemistry/ Immunofluorescence: p38 beta/MAPK11 Antibody [H00005600-B01P] - Analysis of purified antibody to MAPK11 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p38 beta/MAPK11 Antibody Summary

Immunogen
MAPK11 (NP_002742.3, 1 a.a. - 364 a.a.) full-length human protein. MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MAPK11
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p38 beta/MAPK11 Antibody

  • EC 2.7.11
  • EC 2.7.11.24
  • MAP kinase 11
  • MAP kinase p38 beta
  • MAPK 11
  • MAPK11
  • mitogen-activated protein kinase 11
  • Mitogen-activated protein kinase p38 beta
  • mitogen-activated protein kinase p38-2
  • p38 beta
  • p38b
  • p38Beta
  • P38BETA2
  • PRKM11
  • SAPK2B
  • SAPK2p38-2P38B
  • Stress-activated protein kinase 2
  • stress-activated protein kinase-2
  • stress-activated protein kinase-2b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1519
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005600-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for p38 beta/MAPK11 Antibody (H00005600-B01P) (0)

There are no publications for p38 beta/MAPK11 Antibody (H00005600-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 beta/MAPK11 Antibody (H00005600-B01P) (0)

There are no reviews for p38 beta/MAPK11 Antibody (H00005600-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p38 beta/MAPK11 Antibody (H00005600-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p38 beta/MAPK11 Products

Bioinformatics Tool for p38 beta/MAPK11 Antibody (H00005600-B01P)

Discover related pathways, diseases and genes to p38 beta/MAPK11 Antibody (H00005600-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p38 beta/MAPK11 Antibody (H00005600-B01P)

Discover more about diseases related to p38 beta/MAPK11 Antibody (H00005600-B01P).
 

Pathways for p38 beta/MAPK11 Antibody (H00005600-B01P)

View related products by pathway.

PTMs for p38 beta/MAPK11 Antibody (H00005600-B01P)

Learn more about PTMs related to p38 beta/MAPK11 Antibody (H00005600-B01P).
 

Research Areas for p38 beta/MAPK11 Antibody (H00005600-B01P)

Find related products by research area.

Blogs on p38 beta/MAPK11

There are no specific blogs for p38 beta/MAPK11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p38 beta/MAPK11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK11
Entrez
Uniprot