P2Y4/P2RY4 Antibody - BSA Free

Western Blot: P2Y4/P2RY4 Antibody [NBP2-95193] - Analysis of extracts of various cell lines, using P2Y4/P2RY4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.

Product Discontinued

P2Y4/P2RY4 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 286-365 of human P2RY4 (NP_002556.1). VVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for P2Y4/P2RY4 Antibody - BSA Free

• NRU
• P2P
• P2RY4
• P2Y4
• P2Y4P2Y purinoceptor 4
• pyrimidinergic receptor P2Y, G-protein coupled, 4
• UNRNRUUridine nucleotide receptor

Background

The pyrimidinergic receptor P2Y4 (P2RY4) is a member of the Purinergic Receptor subfamily. Membrane-bound P2 receptors mediate the actions of extracellular nucleotides in cell-to-cell signaling. P2Y4 expression has been documented in blood, bone, heart, lung, pancreas, placenta, and umbilical cord.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P2RY4