P2Y1/P2RY1 Antibody

Images

 
Western Blot: P2Y1/P2RY1 Antibody [H00005028-B02P] - Analysis of P2RY1 expression in human kidney.
Western Blot: P2Y1/P2RY1 Antibody [H00005028-B02P] - Analysis of P2RY1 expression in transfected 293T cell line by P2RY1 polyclonal antibody. Lane 1: P2RY1 transfected lysate(42.10 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

P2Y1/P2RY1 Antibody Summary

Immunogen
P2RY1 (NP_002554.1, 1 a.a. - 373 a.a.) full-length human protein. MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
P2RY1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for P2Y1/P2RY1 Antibody

  • ATP receptor
  • P2 purinoceptor subtype Y1
  • P2RY1
  • P2Y purinoceptor 1
  • P2Y1
  • P2Y1platelet ADP receptor
  • purinergic receptor P2Y, G-protein coupled, 1
  • Purinergic receptor

Background

P2Y1 is a Purinergic Receptor that causes a change in platelet shape and potentially leads to platelet aggregation by binding ADP, which results in the mobilization of intracellular calcium ions via activation of phospholipase C. This receptor also mediates the release of the relaxing factor nitric oxide and may be involved in the modulation of neuronal signal transmission. P2Y1 has been reported to be expressed in tissues throughout the body, particularly brain. ESTs have been isolated from human embryo, lung, and placenta libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NLS5011
Species: Hu, Mk, Pm
Applications: IHC-P
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37382
Species: Hu
Applications: WB, ELISA, Flow
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for P2Y1/P2RY1 Antibody (H00005028-B02P) (0)

There are no publications for P2Y1/P2RY1 Antibody (H00005028-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y1/P2RY1 Antibody (H00005028-B02P) (0)

There are no reviews for P2Y1/P2RY1 Antibody (H00005028-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2Y1/P2RY1 Antibody (H00005028-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P2Y1/P2RY1 Products

Bioinformatics Tool for P2Y1/P2RY1 Antibody (H00005028-B02P)

Discover related pathways, diseases and genes to P2Y1/P2RY1 Antibody (H00005028-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2Y1/P2RY1 Antibody (H00005028-B02P)

Discover more about diseases related to P2Y1/P2RY1 Antibody (H00005028-B02P).
 

Pathways for P2Y1/P2RY1 Antibody (H00005028-B02P)

View related products by pathway.

PTMs for P2Y1/P2RY1 Antibody (H00005028-B02P)

Learn more about PTMs related to P2Y1/P2RY1 Antibody (H00005028-B02P).
 

Research Areas for P2Y1/P2RY1 Antibody (H00005028-B02P)

Find related products by research area.

Blogs on P2Y1/P2RY1

There are no specific blogs for P2Y1/P2RY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P2Y1/P2RY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RY1
Entrez
Uniprot