P2Y1/P2RY1 Antibody (4C2)

Immunocytochemistry/Immunofluorescence: P2Y1/P2RY1 Antibody (4C2) [H00005028-M01] - Analysis of monoclonal antibody to P2RY1 on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: P2Y1/P2RY1 Antibody (4C2) [H00005028-M01] - Detection limit for recombinant GST tagged P2RY1 is approximately 1ng/ml as a capture antibody.

Product Discontinued

P2Y1/P2RY1 Antibody (4C2) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: P2RY1 (NP_002554, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
• Specificity: P2RY1 - purinergic receptor P2Y, G-protein coupled, 1 (4C2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: P2RY1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for P2Y1/P2RY1 Antibody (4C2)

• ATP receptor
• P2 purinoceptor subtype Y1
• P2RY1
• P2Y purinoceptor 1
• P2Y1
• P2Y1platelet ADP receptor
• purinergic receptor P2Y, G-protein coupled, 1
• Purinergic receptor

Background

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for P2Y1/P2RY1 Antibody (H00005028-M01)(1)

Publication using H00005028-M01

• Coyle D, O’Donnell AM, Puri P. Altered Distribution of Small-Conductance Calcium-Activated Potassium Channel Sk3 In Hirschsprung’s Disease. Journal of Pediatric Surgery. 2015-01-01 [PMID: 25783396]

Bioinformatics

• Gene Symbol: P2RY1
• Entrez:
  • 5028(Human)
• Uniprot:
  • NP_002554()