Recombinant Human P2X4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related P2X4 Peptides and Proteins

Order Details


    • Catalog Number
      H00005025-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human P2X4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 388 of Human P2RX4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAATNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
P2RX4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
68.42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2X4 Protein

  • ATP receptor
  • ATP-gated cation channel protein
  • P2RX4
  • P2X purinoceptor 4
  • P2X4
  • P2X4P2X receptor, subunit 4
  • P2X4R
  • purinergic receptor P2X, ligand-gated ion channel, 4
  • Purinergic receptor
  • purinoceptor P2X4

Background

P2RX4( AAH33826, 1 a.a. - 389 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-20180
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30565
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30741
Species: Hu, Mu, Rt, GP
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-78249
Species: Hu, Rt, Pm
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, IP
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NBP2-61760
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1028
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC

Publications for P2X4 Recombinant Protein (H00005025-P01) (0)

There are no publications for P2X4 Recombinant Protein (H00005025-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X4 Recombinant Protein (H00005025-P01) (0)

There are no reviews for P2X4 Recombinant Protein (H00005025-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2X4 Recombinant Protein (H00005025-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional P2X4 Products

Bioinformatics Tool for P2X4 Recombinant Protein (H00005025-P01)

Discover related pathways, diseases and genes to P2X4 Recombinant Protein (H00005025-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X4 Recombinant Protein (H00005025-P01)

Discover more about diseases related to P2X4 Recombinant Protein (H00005025-P01).
 

Pathways for P2X4 Recombinant Protein (H00005025-P01)

View related products by pathway.

PTMs for P2X4 Recombinant Protein (H00005025-P01)

Learn more about PTMs related to P2X4 Recombinant Protein (H00005025-P01).

Blogs on P2X4

There are no specific blogs for P2X4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human P2X4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX4
Entrez