P2X1/P2RX1 Antibody

Images

 
Western Blot: P2X1/P2RX1 Antibody [H00005023-D01P] - Analysis of P2RX1 expression in transfected 293T cell line by P2RX1 polyclonal antibody.Lane 1: P2RX1 transfected lysate(45.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P2X1/P2RX1 Antibody Summary

Immunogen
P2RX1 (NP_002549.1, 1 a.a. - 399 a.a.) full-length human protein. MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P2RX1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for P2X1/P2RX1 Antibody

  • ATP receptor
  • P2RX1
  • P2X purinoceptor 1
  • P2X receptor, subunit 1
  • P2X1
  • P2X1P2X1 receptor
  • P2XMR
  • purinergic receptor P2X, ligand-gated ion channel, 1
  • Purinergic receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-30741
Species: Hu, Mu, Rt, GP
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NBP1-30565
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IHC-FrFl
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NLS5011
Species: Hu, Mk, Pm
Applications: IHC-P

Publications for P2X1/P2RX1 Antibody (H00005023-D01P) (0)

There are no publications for P2X1/P2RX1 Antibody (H00005023-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X1/P2RX1 Antibody (H00005023-D01P) (0)

There are no reviews for P2X1/P2RX1 Antibody (H00005023-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2X1/P2RX1 Antibody (H00005023-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P2X1/P2RX1 Products

Bioinformatics Tool for P2X1/P2RX1 Antibody (H00005023-D01P)

Discover related pathways, diseases and genes to P2X1/P2RX1 Antibody (H00005023-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X1/P2RX1 Antibody (H00005023-D01P)

Discover more about diseases related to P2X1/P2RX1 Antibody (H00005023-D01P).
 

Pathways for P2X1/P2RX1 Antibody (H00005023-D01P)

View related products by pathway.

Research Areas for P2X1/P2RX1 Antibody (H00005023-D01P)

Find related products by research area.

Blogs on P2X1/P2RX1

There are no specific blogs for P2X1/P2RX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P2X1/P2RX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX1
Entrez
Uniprot