Otolin-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OTOL1 Antibody [NBP1-90699] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and golgi apparatus.
Immunohistochemistry-Paraffin: OTOL1 Antibody [NBP1-90699] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Otolin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTOL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Otolin-1 Recombinant Protein Antigen (NBP1-90699PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Otolin-1 Antibody

  • C1q and tumor necrosis factor related protein 15
  • C1qTNF15
  • LOC131149
  • OTOL1
  • otolin 1
  • Otolin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF6235
Species: Hu
Applications: WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3127
Species: Hu
Applications: WB, IHC, IP
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
MAB2607
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF5784
Species: Hu
Applications: WB
MAB3124
Species: Hu, Mu
Applications: WB
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Otolin-1 Antibody (NBP1-90699) (0)

There are no publications for Otolin-1 Antibody (NBP1-90699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Otolin-1 Antibody (NBP1-90699) (0)

There are no reviews for Otolin-1 Antibody (NBP1-90699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Otolin-1 Antibody (NBP1-90699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Otolin-1 Products

Bioinformatics Tool for Otolin-1 Antibody (NBP1-90699)

Discover related pathways, diseases and genes to Otolin-1 Antibody (NBP1-90699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Otolin-1 Antibody (NBP1-90699)

Discover more about diseases related to Otolin-1 Antibody (NBP1-90699).

Blogs on Otolin-1

There are no specific blogs for Otolin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Otolin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTOL1
Entrez