ORL1/OPRL1 Antibody (2A11)

Images

 
Sandwich ELISA: ORL1/OPRL1 Antibody (2A11) [H00004987-M02] - Detection limit for recombinant GST tagged OPRL1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ORL1/OPRL1 Antibody (2A11) Summary

Immunogen
OPRL1 (AAH38433, 110 a.a. - 212 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDYWG
Specificity
OPRL1 (2A11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OPRL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ORL1/OPRL1 Antibody (2A11)

  • Kappa-type 3 opioid receptor
  • KOR-3
  • KOR-3MGC34578
  • N/OFQ Receptor
  • Nociceptin Receptor
  • NOCIR
  • NOP Receptor
  • OOR
  • OORORL1kappa3-related opioid receptor
  • opiate receptor-like 1
  • OPRL1
  • ORL1
  • Orphanin FQ Receptor

Background

The protein encoded by this gene is a G protein-coupled receptor whose expression can be induced by phytohemagglutinin. The encoded integral membrane protein is a receptor for the 17 aa neuropeptide nociceptin/orphanin FQ. This gene may be involved in the regulation of numerous brain activities, particularly instinctive and emotional behaviors. A promoter for this gene also functions as a promoter for another gene, regulator of G-protein signalling 19 (RGS19), located on the opposite strand. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1619
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB38951
Species: Hu
Applications: IHC
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ORL1/OPRL1 Antibody (H00004987-M02) (0)

There are no publications for ORL1/OPRL1 Antibody (H00004987-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORL1/OPRL1 Antibody (H00004987-M02) (0)

There are no reviews for ORL1/OPRL1 Antibody (H00004987-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ORL1/OPRL1 Antibody (H00004987-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ORL1/OPRL1 Products

Bioinformatics Tool for ORL1/OPRL1 Antibody (H00004987-M02)

Discover related pathways, diseases and genes to ORL1/OPRL1 Antibody (H00004987-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORL1/OPRL1 Antibody (H00004987-M02)

Discover more about diseases related to ORL1/OPRL1 Antibody (H00004987-M02).

Research Areas for ORL1/OPRL1 Antibody (H00004987-M02)

Find related products by research area.

Blogs on ORL1/OPRL1

There are no specific blogs for ORL1/OPRL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORL1/OPRL1 Antibody (2A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol OPRL1
Entrez
OMIM
Uniprot