Obox6 Antibody

Images

 
Western Blot: Obox6 Antibody [NBP1-91619] - SP2/0 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Obox6 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of mouse OBOX6. Peptide sequence MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OBOX6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against OBOX6 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Obox6 Antibody

  • oocyte specific homeobox 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81885
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6646
Species: Hu
Applications: WB
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5964
Species: Hu
Applications: WB, IP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91619
Species: Mu
Applications: WB

Publications for Obox6 Antibody (NBP1-91619) (0)

There are no publications for Obox6 Antibody (NBP1-91619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Obox6 Antibody (NBP1-91619) (0)

There are no reviews for Obox6 Antibody (NBP1-91619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Obox6 Antibody (NBP1-91619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Obox6 Products

Array NBP1-91619

Bioinformatics Tool for Obox6 Antibody (NBP1-91619)

Discover related pathways, diseases and genes to Obox6 Antibody (NBP1-91619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Obox6 Antibody (NBP1-91619)

Discover more about diseases related to Obox6 Antibody (NBP1-91619).

Blogs on Obox6

There are no specific blogs for Obox6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Obox6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OBOX6
Uniprot