NUDT12 Antibody


Western Blot: NUDT12 Antibody [NBP1-52974] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NUDT12 Antibody Summary

Synthetic peptides corresponding to NUDT12(nudix (nucleoside diphosphate linked moiety X)-type motif 12) The peptide sequence was selected from the C terminal of NUDT12. Peptide sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NUDT12 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NUDT12 Antibody

  • DKFZp761I172
  • EC
  • nucleoside diphosphate linked moiety X-type motif 12
  • Nucleoside diphosphate-linked moiety X motif 12
  • nudix (nucleoside diphosphate linked moiety X)-type motif 12
  • Nudix motif 12
  • peroxisomal NADH pyrophosphatase NUDT12


Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-299 CB131118.1 1-299 300-344 BC041099.1 296-340 345-492 CB131118.1 345-492 493-993 BC041099.1 489-989 994-1171 BU621954.1 461-638 1172-3502 BC026748.1 206-2536


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for NUDT12 Antibody (NBP1-52974) (0)

There are no publications for NUDT12 Antibody (NBP1-52974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT12 Antibody (NBP1-52974) (0)

There are no reviews for NUDT12 Antibody (NBP1-52974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT12 Antibody (NBP1-52974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUDT12 Products

Bioinformatics Tool for NUDT12 Antibody (NBP1-52974)

Discover related pathways, diseases and genes to NUDT12 Antibody (NBP1-52974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for NUDT12 Antibody (NBP1-52974)

Find related products by research area.

Blogs on NUDT12

There are no specific blogs for NUDT12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUDT12 Antibody and receive a gift card or discount.


Gene Symbol NUDT12