noxin Antibody (NBP2-48685)

Images

 
Immunocytochemistry/ Immunofluorescence: noxin Antibody [NBP2-48685] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: noxin Antibody [NBP2-48685] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

noxin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:GFTVIDYFHQLLQTFNFRKLQCDSQAPNNHLLALDHSNSDLSSIYTSDSTSDFFKSCSKDTFSKFWQPSLEFTCIVSQLTDNDDFSASEQSKAFGTLQQNRKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11ORF82
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for noxin Antibody

  • C11orf82
  • chromosome 11 open reading frame 82
  • FLJ13936
  • FLJ25416
  • FLJ38838
  • nitric oxide-inducible gene protein
  • noxin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-48685
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for noxin Antibody (NBP2-48685) (0)

There are no publications for noxin Antibody (NBP2-48685).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for noxin Antibody (NBP2-48685) (0)

There are no reviews for noxin Antibody (NBP2-48685). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for noxin Antibody (NBP2-48685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional noxin Antibody Products

Related Products by Gene

Bioinformatics Tool for noxin Antibody (NBP2-48685)

Discover related pathways, diseases and genes to noxin Antibody (NBP2-48685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on noxin

There are no specific blogs for noxin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our noxin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11ORF82

Customers Who Bought This Also Bought