NKX1-2 Antibody


Western Blot: NKX1-2 Antibody [NBP2-14498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NKX1-2 Antibody [NBP2-14498] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NKX1-2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVK
Specificity of human NKX1-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NKX1-2 Protein (NBP2-14498PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NKX1-2 Antibody

  • bB238F13.2
  • C10orf121
  • NKX-1.1
  • NKX1-2 NK1 homeobox 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, ChIP, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NKX1-2 Antibody (NBP2-14498) (0)

There are no publications for NKX1-2 Antibody (NBP2-14498).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX1-2 Antibody (NBP2-14498) (0)

There are no reviews for NKX1-2 Antibody (NBP2-14498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKX1-2 Antibody (NBP2-14498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NKX1-2 Products

NKX1-2 NBP2-14498

Bioinformatics Tool for NKX1-2 Antibody (NBP2-14498)

Discover related pathways, diseases and genes to NKX1-2 Antibody (NBP2-14498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX1-2 Antibody (NBP2-14498)

Discover more about diseases related to NKX1-2 Antibody (NBP2-14498).

Pathways for NKX1-2 Antibody (NBP2-14498)

View related products by pathway.

Blogs on NKX1-2

There are no specific blogs for NKX1-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NKX1-2 Antibody and receive a gift card or discount.


Gene Symbol NKX1-2