Recombinant Human NETO2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NETO2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 426-525 of Human NETO2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF

Protein/Peptide Type
Partial Recombinant Protein
Gene
NETO2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NETO2 Protein

  • Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 2
  • BTCL2
  • FLJ10430
  • FLJ90456
  • NEOT2
  • NEOT2FLJ14724
  • NETO2
  • neuropilin (NRP) and tolloid (TLL)-like 2
  • neuropilin and tolloid-like protein 2

Background

This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4337
Species: Hu
Applications: WB, IHC, ICC
H00051144-M08
Species: Hu
Applications: WB, ELISA
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-31881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01625
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
H00081831-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NETO2 Partial Recombinant Protein (H00081831-Q01) (0)

There are no publications for NETO2 Partial Recombinant Protein (H00081831-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NETO2 Partial Recombinant Protein (H00081831-Q01) (0)

There are no reviews for NETO2 Partial Recombinant Protein (H00081831-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NETO2 Partial Recombinant Protein (H00081831-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NETO2 Products

Bioinformatics Tool for NETO2 Partial Recombinant Protein (H00081831-Q01)

Discover related pathways, diseases and genes to NETO2 Partial Recombinant Protein (H00081831-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NETO2 Partial Recombinant Protein (H00081831-Q01)

Discover more about diseases related to NETO2 Partial Recombinant Protein (H00081831-Q01).
 

Pathways for NETO2 Partial Recombinant Protein (H00081831-Q01)

View related products by pathway.

Blogs on NETO2

There are no specific blogs for NETO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VPS35 Antibody
NB100-1397
NETO2 Antibody
NBP1-84624

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NETO2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NETO2
Entrez