Recombinant Human NDUFS8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NDUFS8 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 27 - 136 of Human NDUFS8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADG

Protein/Peptide Type
Partial Recombinant Protein
Gene
NDUFS8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFS8 Protein

  • CI-23k
  • CI23KD
  • CI-23kD
  • complex I 23kDa subunit
  • Complex I-23kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • NADH dehydrogenase (ubiquinone) Fe-S protein 8 (23kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
  • NADH-ubiquinone oxidoreductase 23 kDa subunit
  • TYKY subunit
  • TYKY

Background

NDUFS8 - NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00374291-P01
Species: Hu
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004700-R01
Species: Hu
NBP1-31465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-26161
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-57265
Species: Hu
Applications: WB, ICC/IF
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004728-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NDUFS8 Partial Recombinant Protein (H00004728-Q01) (0)

There are no publications for NDUFS8 Partial Recombinant Protein (H00004728-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS8 Partial Recombinant Protein (H00004728-Q01) (0)

There are no reviews for NDUFS8 Partial Recombinant Protein (H00004728-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFS8 Partial Recombinant Protein (H00004728-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFS8 Products

Bioinformatics Tool for NDUFS8 Partial Recombinant Protein (H00004728-Q01)

Discover related pathways, diseases and genes to NDUFS8 Partial Recombinant Protein (H00004728-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS8 Partial Recombinant Protein (H00004728-Q01)

Discover more about diseases related to NDUFS8 Partial Recombinant Protein (H00004728-Q01).
 

Pathways for NDUFS8 Partial Recombinant Protein (H00004728-Q01)

View related products by pathway.

PTMs for NDUFS8 Partial Recombinant Protein (H00004728-Q01)

Learn more about PTMs related to NDUFS8 Partial Recombinant Protein (H00004728-Q01).

Blogs on NDUFS8

There are no specific blogs for NDUFS8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NDUFS8 Antibody
NBP1-85620
DDB1 Antibody
NBP1-33061

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDUFS8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS8