NADK Antibody

Immunohistochemistry-Paraffin: NADK Antibody [NBP2-13637] Staining of human stomach, upper shows distinct cytoplasmic positivity in glandular cells.

Product Discontinued

NADK Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NADK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NADK Protein (NBP2-13637PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NADK Antibody

• dJ283E3.1
• DKFZp686L22239
• EC 2.7.1
• EC 2.7.1.23
• FLJ13052
• FLJ37724
• FLJ54695
• FLJ77769
• FLJ78247
• FLJ78307
• MGC1900
• NAD kinase
• NADK
• Poly(P)/ATP NAD kinase

Background

NADK catalyzes the transfer of a phosphate group from ATP to NAD to generate NADP, which in its reduced form acts as an electron donor for biosynthetic reactions (Lerner et al., 2001 [PubMed 11594753]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NADK