Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody

Western Blot: Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody [H00001131-A01] - Analysis of CHRM3 expression in PC-12 (Cat # L012V1).

Western Blot: Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody [H00001131-A01] - Western Blot detection against Immunogen (33.48 KDa) .

Product Discontinued

Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CHRM3 (NP_000731, 1 a.a. - 67 a.a.) partial recombinant protein with GST tag. MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ
• Specificity: CHRM3 - cholinergic receptor, muscarinic 3
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CHRM3
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Bovine reactivity reported in scientific literature (PMID: 24828018).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50 % glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody

• cholinergic receptor, muscarinic 3
• CHRM3
• HM3
• m3 muscarinic receptor
• mAChR M3
• muscarinic acetylcholine receptor M3

Background

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (H00001131-A01)(2)

Publications using H00001131-A01

• Klee, George G, Vasmatzis, George, Kosari et al. EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERS FreshPatents 2010-02-04 (ELISA, Human)
• Cheng Yan-Mei, Cao Ai-Li, Zheng Jian-Pu et al. Airway hyperresponsiveness induced by repeated esophageal infusion of HCl in guinea pigs. Am J Respir Cell Mol Biol. 2014-11-01 [PMID: 24828018] (Bovine)

Bioinformatics

• Gene Symbol: CHRM3
• Entrez:
  • 1131(Human)
• OMIM:
  • 118494(Human)
• Uniprot:
  • NP_000731()