mtRNA polymerase Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

mtRNA polymerase Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLRMT.
  
  

  Source: E. coli

  Amino Acid Sequence: ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: POLRMT
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90126.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for mtRNA polymerase Recombinant Protein Antigen

• APOLMTEC 2.7.7.6
• DNA-directed RNA polymerase, mitochondrial
• EC 2.7.7.6
• h-mtRPOL
• mtRNA polymerase
• MTRNAP
• MtRPOL
• POLRMT
• polymerase (RNA) mitochondrial (DNA directed)

Background

POLRMT, also known as DNA-directed RNA polymerase, mitochondrial, is a 246 amino acid protein that is 28 kDa, catalyzes the transcription of mitochondrial DNA into RNA using the four ribonucleoside triphosphates as substrates. This protein is currently being studied for research on autosomal dominant progressive external ophthalmoplegia, essential thrombocythemia, ophthalmoplegia, immunodeficiency, and malaria. This protein has also shown to have interactions with TFB1M, NFKB2, ICT1, TFB2M, TFAM, and over 200 other proteins in ATP/ITP metabolism, mitochondrial gene expression, transcription from mitochondrial promoters, transcription, RNA polymerase I, RNA polymerase III, and mitochondrial transcription, gene expression, and mitochondrial transcription initiation pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: POLRMT